| 保存条件 | 冷藏/冷冻 |
| 保质期 | -20°C |
| 英文名 | Bone Morphogenetic Protein-7 Human Recombinant, His Tag |
| 数量 | 大量 |
| 供应商 | 上海经科化学科技有限公司 |
| CAS号 | 无 |
| 规格 | 10ug/50ug/1mg |
| Catalogue Number | CYT-333 |
| Synonyms | Osteogenic Protein 1, BMP-7. |
| Introduction | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. |
| Description | Bone Morphogenetic Protein-7 Human Recombinant produced in E.Coli is a monomeric, non-glycosylated, polypeptide chain containing 139 amino acids and having a molecular mass of 15679.97 Dalton. The BMP-7 is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | BMP-7 was lyophilized from a concentrated (1mg/ml) sterile solution containing 10mM sodium citrate pH=3.5. |
| Solubility | It is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in 20mM-100mM acetic acid at a concentration of 0.1-0.5mg per ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. |
| Stability | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Purity | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Catalogue Number | CYT-276 |
| Synonyms | Osteogenic Protein 1, BMP-7. |
| Introduction | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. |
| Description | N-TERMINAL---Human BMP-2 (Met 1 – Arg 282) Human BMP-7 (Ser 293 – Arg 431)---C-TERMINAL. The DNA sequence encoding the human BMP-2 signal peptide and propeptide (1~282 amino acid) fused to the human rhBMP-7 mature chain (293~431 amino acid) was expressed in a Chinese hamster ovary cell line. The mature recombinant BMP-7 generated by the proteolytic removal of the signal peptide and propetide contains 139 amino acid residues. The glycosylation of BMP-7 increases the molecular mass and the glycosylated proteins migrate as 25 ~ 40 kDa in SDS-PAGE under non-reducing conditions. BMP-7 is purified by proprietary chromatographic techniques. |
| Source | Chinese Hamster Ovarian Cells. |
| Formulation | BMP-7 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1% sucrose, 1.2% mannitol, 20mM glycine and 0.05% polysorbate 20 pH-4. |
| Solubility | It is recommended to reconstitute the lyophilized Bone Morphogenetic Protein-7 in 0.5mg/1ml sterile/ endotoxin free water. |
| Stability | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Purity | Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Biological Activity | Measured in alkaline phosphatase activity assay using MC3T3-E1 cells. The ED50 for this effect is < 70ng/ml, corresponding to a Specific Activity of 14,286IU/mg. |
| Catalogue Number | CYT-082 |
| Synonyms | Osteogenic Protein 1, BMP-7. |
| Introduction | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. |
| Description | BMP-7 Human Recombinant produced in HEK cells is a glycosylated disulfide-linked homodimer, having a molecular weight range of 30-38kDa due to glycosylation. The BMP7 corresponds to amino acid residues 315 to 431 of the full-length BMP-7 precursor and is purified by proprietary chromatographic techniques. |
| Source | HEK. |
| Physical Appearence | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The BMP7 was lyophilized from 1mg/ml in 1xPBS. |
| Solubility | It is recommended to reconstitute the lyophilized BMP-7 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability | Lyophilized BMP7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-7 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Purity | Greater than 95% as obsereved by SDS-PAGE. |
| Biological Activity | The specific activity was determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 50-250ng/ml. |
| Catalogue Number | CYT-629 |
| Synonyms | Osteogenic Protein 1, OP-1, BMP-7, Bone morphogenetic protein 7, BMP7, OP1. |
| Introduction | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. |
| Description | BMP7 Human Recombinant produced in E.Coli is a monomeric, non-glycosylated, polypeptide chain containing 148 amino acids (293-431) and having a molecular mass of 16.8 kDa. The BMP-7 is fused to 8 amino acid His Tag at C-terminus & purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered colorless solution. |
| Formulation | BMP-7 protein solution contains 10mM sodium citrate pH=3.5 and 10% glycerol. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Amino acid sequence | MSTGSKQRSQ NRSKTPKNQE ALRMANVAEN SSSDQRQACK KHELYVSFRD LGWQDWIIAP EGYAAYYCEG ECAFPLNSYM NATNHAIVQTLVHFINPETV PKPCCAPTQL NAISVLYFDD SSNVILKKYR NMVVRACGCH LEHHHHHH. |
| Catalogue Number | CYT-039 |
| Synonyms | Osteogenic Protein 1, BMP-7. |
| Introduction | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. |
| Description | Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques. |
| Source | Nicotiana benthamiana. |
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
| Solubility | Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl. |
| Stability | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Purity | Greater than 97.0% as determined by SDS-PAGE. |
| Amino acid sequence | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. |
| Biological Activity | The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg. |
